Proteintech, 10926-1-AP, Renin receptor, ATP6AP2 Polyclonal antibody

Size: 20ul / 150ul The Renin receptor, ATP6AP2 (10926-1-AP) by Proteintech is a Polyclonal antibody targeting Renin receptor, ATP6AP2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10926-1-AP targets Renin receptor, ATP6AP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, human retinal pigment epithelium tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissue, human heart tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ATP6AP2, also named as ATP6IP2, CAPER, ELDF10, N14F, ATP6M8-9, Renin receptor, and prorenin receptor, is believed to potentiate the renin-angiotensin system (RAS), conferring to prorenin, a likely pathological role at the tissue level. The PRR has been identified in the microvascular endothelial cells of the retina, which seems to be involved in pathological neovascularization processes. The present study demonstrates for the first time that the PRR is expressed in human ATP6AP2 and suggests a molecular mechanism by which hypertension may exacerbate the pathology of dry AMD. ATP6AP2 functions as a renin and prorenin cellular receptor. It may mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS). Defects in ATP6AP2 are a cause of mental retardation X-linked with epilepsy (MRXE). The full length of ATP6AP2 protein is 39 kDa, and the band with an apparent molecular weight of 28 kDa is the soluble form.(PMID:19580809; PMID:28215051; PMID:34534267; PMID: 29127204) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1360 Product name: Recombinant human RENIN-RECEPTOR,ATP6AP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC010395 Sequence: MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQANPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD Predict reactive species Full Name: ATPase, H+ transporting, lysosomal accessory protein 2 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC010395 Gene Symbol: Renin receptor Gene ID (NCBI): 10159 RRID: AB_2062201 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75787 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.