Proteintech, 10931-1-AP, MEF2BNB Polyclonal antibody

Size: 20ul / 150ul The MEF2BNB (10931-1-AP) by Proteintech is a Polyclonal antibody targeting MEF2BNB in WB, IHC, ELISA applications with reactivity to human, mouse samples 10931-1-AP targets MEF2BNB in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human brain tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1370 Product name: Recombinant human MEF2BNB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC010931 Sequence: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA Predict reactive species Full Name: hypothetical protein LOC729991 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 12-15 kDa, 32 kDa GenBank Accession Number: BC010931 Gene Symbol: MEF2BNB Gene ID (NCBI): 729991 RRID: AB_530408 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96FH0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.