Proteintech, 10934-1-AP, Cyclin D2 Polyclonal antibody

Size: 20ul / 150ul The Cyclin D2 (10934-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclin D2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10934-1-AP targets Cyclin D2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, MCF-7 cells, NIH/3T3 cells, U2OS cells, HEK-293 cells Positive IHC detected in: human renal cell carcinoma tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CCND2 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. CCND2 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. CCND2 has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. High level expression of CCND2 was observed in ovarian and testicular tumors. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, bovine, sheep, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1377 Product name: Recombinant human CCND2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC010958 Sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL Predict reactive species Full Name: cyclin D2 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC010958 Gene Symbol: Cyclin D2 Gene ID (NCBI): 894 RRID: AB_2275319 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.