Proteintech, 10936-1-AP, YWHAB Polyclonal antibody

Size: 20ul / 150ul The YWHAB (10936-1-AP) by Proteintech is a Polyclonal antibody targeting YWHAB in IHC, IF/ICC, ELISA applications with reactivity to human samples 10936-1-AP targets YWHAB in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information YWHAB (also known as 14-3-3 beta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised agaist the N-terminal region of human YWHAB. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1383 Product name: Recombinant human YWHAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC010352 Sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT Predict reactive species Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide Calculated Molecular Weight: 28 kDa GenBank Accession Number: BC010352 Gene Symbol: YWHAB Gene ID (NCBI): 7529 RRID: AB_2217489 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31946 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.