Proteintech, 10953-1-AP, HMGN2 Polyclonal antibody

Size: 20ul / 150ul The HMGN2 (10953-1-AP) by Proteintech is a Polyclonal antibody targeting HMGN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 10953-1-AP targets HMGN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, HepG2 cells, HL-60 cells, K-562 cells Positive IHC detected in: human prostate cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HMGN2 is a highly conserved nucleosomal protein which may involve in unfolding higher-order chromatin structure and facilitating the transcriptional activation of mammalian genes. It is the most abundant, ubiquitous and evolutionarily conserved nonhistione proteins found in the nuclei of higher eukaryotes. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1401 Product name: Recombinant human HMGN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC014644 Sequence: MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK Predict reactive species Full Name: high-mobility group nucleosomal binding domain 2 Calculated Molecular Weight: 9 aa, 3 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC014644 Gene Symbol: HMGN2 Gene ID (NCBI): 3151 RRID: AB_2118482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.