Proteintech, 10959-1-AP, PSMG2 Polyclonal antibody

Size: 20ul / 150ul The PSMG2 (10959-1-AP) by Proteintech is a Polyclonal antibody targeting PSMG2 in WB, ELISA applications with reactivity to human samples 10959-1-AP targets PSMG2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Proteasome assembly chaperone 2 (PSMG2), also named as Hepatocellular carcinoma-susceptibility protein 3, Tumor necrosis factor superfamily member 5-induced protein 1. It has a function as a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.It is widely expressed with highest levels in lung, brain and colon,moderately expressed in muscle, stomach, spleen and heart and weakly expressed in small intestine, pancreas and liver,highly expressed in hepatocellular carcinomas with low levels in surrounding liver tissue. Molecular mass of PSMG2 is 29kD. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1400 Product name: Recombinant human PSMG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC013356 Sequence: MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF Predict reactive species Full Name: proteasome (prosome, macropain) assembly chaperone 2 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC013356 Gene Symbol: PSMG2 Gene ID (NCBI): 56984 RRID: AB_2171454 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969U7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.