Proteintech, 10961-1-AP, ARL3 Polyclonal antibody

Size: 20ul / 150ul The ARL3 (10961-1-AP) by Proteintech is a Polyclonal antibody targeting ARL3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, canine samples 10961-1-AP targets ARL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: mouse brain tissue, PC-3 cells, human brain tissue, mouse testis tissue, rat brain tissue, HeLa cells, rat testis tissue Positive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MDCK cells, IMCD3 cells, hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ARL3 (ADP-ribosylation factor-like 3) is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. ARL3 is believed to be involved in ciliary and microtubule-dependent processes. Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1406 Product name: Recombinant human ARL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC009841 Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK Predict reactive species Full Name: ADP-ribosylation factor-like 3 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa, 25 kDa GenBank Accession Number: BC009841 Gene Symbol: ARL3 Gene ID (NCBI): 403 RRID: AB_2274220 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.