Iright
BRAND / VENDOR: Proteintech

Proteintech, 10962-2-AP, Destrin Polyclonal antibody

CATALOG NUMBER: 10962-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Destrin (10962-2-AP) by Proteintech is a Polyclonal antibody targeting Destrin in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 10962-2-AP targets Destrin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, PC-3 cells, SKOV-3 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Destrin (also known as actin depolymerization factor, ADF) is an actin-binding protein contributing to cytoskeletal dynamics by promoting rapid actin filament disassembly. By regulating actin cytoskeletal reorganization it plays an important role in the formation of filopodia, which further promotes tumor cell invasion and metastasis. Destrin has been reported to be overexpressed in primary colon cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1402 Product name: Recombinant human DSTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009477 Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV Predict reactive species Full Name: destrin (actin depolymerizing factor) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC009477 Gene Symbol: Destrin Gene ID (NCBI): 11034 RRID: AB_2230671 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924