Iright
BRAND / VENDOR: Proteintech

Proteintech, 10978-1-AP, HSD17B2 Polyclonal antibody

CATALOG NUMBER: 10978-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HSD17B2 (10978-1-AP) by Proteintech is a Polyclonal antibody targeting HSD17B2 in WB, IHC, ELISA applications with reactivity to human samples 10978-1-AP targets HSD17B2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, human placenta tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information HSD17B2(Estradiol 17-beta-dehydrogenase 2) is also named as 17-beta-HSD 2,20-alpha-HSD,EDH17B2 and belongs to the short-chain dehydrogenases/reductases (SDR) family.Based on the pivotal role of HSD17B2 gene product in the estrogen metabolism pathway, it may be considered as a putative candidate gene that could possibly explain a fraction of the remaining familial breast cancer risk and it is unlikely to play a role as a high penetrance gene in breast cancer predisposition(PMID:18372405). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1411 Product name: Recombinant human HSD17B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-387 aa of BC009581 Sequence: MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 2 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC009581 Gene Symbol: HSD17B2 Gene ID (NCBI): 3294 RRID: AB_2279863 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P37059 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924