Proteintech, 10986-1-AP, GRIM19 Polyclonal antibody

Size: 20ul / 150ul The GRIM19 (10986-1-AP) by Proteintech is a Polyclonal antibody targeting GRIM19 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10986-1-AP targets GRIM19 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, HEK-293 cells, MCF-7 cells, rat heart tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human prostate cancer tissue, human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GRIM19(Gene associated with retinoic and interferon-induced mortality 19 protein) is also named as NDUFA13 ,CI-B16.6 and belongs to the complex I NDUFA13 subunit family.t GRIM-19 may distribute in the mitochondria and/or nucleus depending on the cell type.Alternatively, its cellular localization may be regulated by post-translational modifications such as phosphorylation and acetylation. Lastly, GRIM-19 may exist in different isoforms that may be distributed in distinct cellular locations(PMID:12628925). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1435 Product name: Recombinant human GRIM19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC009189 Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 Calculated Molecular Weight: 16.5 kDa Observed Molecular Weight: 16-18 kDa GenBank Accession Number: BC009189 Gene Symbol: GRIM19 Gene ID (NCBI): 51079 RRID: AB_2150609 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0J0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.