Proteintech, 10993-1-AP, Cytochrome c Polyclonal antibody

Size: 20ul / 150ul The Cytochrome c (10993-1-AP) by Proteintech is a Polyclonal antibody targeting Cytochrome c in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 10993-1-AP targets Cytochrome c in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, NIH/3T3 cells, rat liver tissue, HEK-293 cells, HepG2 cells, C2C12 cells, Jurkat cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human liver tissue, human breast cancer tissue, human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c ca99n be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey, chicken, hamster, sheep, goat, hippospongia Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1455 Product name: Recombinant human Cytochrome c protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Predict reactive species Full Name: cytochrome c, somatic Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12-15 kDa GenBank Accession Number: BC009578 Gene Symbol: Cytochrome c Gene ID (NCBI): 54205 RRID: AB_2090467 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P99999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.