Proteintech, 10997-2-AP, POLG2 Polyclonal antibody

Size: 20ul / 150ul The POLG2 (10997-2-AP) by Proteintech is a Polyclonal antibody targeting POLG2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10997-2-AP targets POLG2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse colon tissue, HeLa cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information mtDNA is replicated by DNA polymerase gamma, which is composed of a catalytic (encoded by POLG) and an accessory subunit (encoded by POLG2). POLG2(DNA polymerase subunit gamma-2, mitochondrial) can stimulate the polymerase and exonuclease activities (PMID: 37085601). Defects in POLG2 are the cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 4 (PEOA4) (PMID: 16685652).Western blot result suggested that the POLG2 expressed in human fetal kidney and U-251 MG cell lines with a single band of 55kd. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1424 Product name: Recombinant human POLG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-485 aa of BC009194 Sequence: GPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPAYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV Predict reactive species Full Name: polymerase (DNA directed), gamma 2, accessory subunit Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC009194 Gene Symbol: POLG2 Gene ID (NCBI): 11232 RRID: AB_2299887 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHN1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.