Proteintech, 11006-1-AP, PPAN Polyclonal antibody

Size: 20ul / 150ul The PPAN (11006-1-AP) by Proteintech is a Polyclonal antibody targeting PPAN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11006-1-AP targets PPAN in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, rat heart tissue, rat liver tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information PPAN (or SSF, SSF1 or SSF2) gene is widely expressed, and encodes peter pan homolog protein which may be localized in nucleus. Two isoforms are produced through alternative splicing. So far the characterization of this protein is largely unknown, multiple phosphorylation sites has been revealed based on high-throughput phosphorylation analysis. This antibody is raised against the C-terminal of huaman PPAN and recognize bands around 55 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, xenopus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1419 Product name: Recombinant human PPAN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-473 aa of BC009833 Sequence: LNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA Predict reactive species Full Name: peter pan homolog (Drosophila) Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC009833 Gene Symbol: PPAN Gene ID (NCBI): 56342 RRID: AB_2168040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.