Proteintech, 11009-1-AP, Midkine Polyclonal antibody

Size: 20ul / 150ul The Midkine (11009-1-AP) by Proteintech is a Polyclonal antibody targeting Midkine in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11009-1-AP targets Midkine in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse embryo tissue, COLO 320 cells, SH-SY5Y cells Positive IP detected in: mouse embryo tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Midkine is a heparin-binding growth factor identified over 20 years ago and enhances the survival, migration and many other activities of target cells. Midkine is rich in both basic amino acids and cysteine, and is not related to most other growth factors/cytokines. It is strongly expressed during embryonic periods, especially at the midgestation stage, and plays important roles in development, especially in neurogenesis. Midkine expression in adult tissue is generally weak or undetectable, and it is induced upon injury and exerts many activities related to tissue repair. The biological activities of midkine in malignant tumors include proliferation, angiogenesis, invasion and metastasis. Various cancers express significantly higher levels of the midkine protein in early stage tumor tissues than in adjacent normal tissue. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1465 Product name: Recombinant human MDK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC011704 Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD Predict reactive species Full Name: midkine (neurite growth-promoting factor 2) Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC011704 Gene Symbol: Midkine Gene ID (NCBI): 4192 RRID: AB_2250619 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21741 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.