Proteintech, 11010-1-AP, GABARAPL1 Polyclonal antibody

Size: 20ul / 150ul The GABARAPL1 (11010-1-AP) by Proteintech is a Polyclonal antibody targeting GABARAPL1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11010-1-AP targets GABARAPL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HepG2 cells, human heart tissue, mouse liver tissue, rat brain tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: mouse brain tissue, human ovary tumor tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Chloroquine treated HeLa cells, Chloroquine treated HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene, and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy, like GABARAP and GABARAPL2, and may be considered an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle, and at very low levels in the thymus and small intestine. The antibody is specific to GABARAPL1, and it doesn't recognize the recombinant GABARAP and GABARAPL2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, prawn Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species Full Name: GABA(A) receptor-associated protein like 1 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC009309 Gene Symbol: GABARAPL1 Gene ID (NCBI): 23710 RRID: AB_2294415 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0R8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.