Iright
BRAND / VENDOR: Proteintech

Proteintech, 11037-2-AP, Glutamine Synthetase Polyclonal antibody

CATALOG NUMBER: 11037-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Glutamine Synthetase (11037-2-AP) by Proteintech is a Polyclonal antibody targeting Glutamine Synthetase in WB, IHC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 11037-2-AP targets Glutamine Synthetase in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse liver tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue, human brain tissue, mouse eye tissue Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts(PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1510 Product name: Recombinant human Glutamine synthetase protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-373 aa of BC011700 Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN Predict reactive species Full Name: glutamate-ammonia ligase (glutamine synthetase) Calculated Molecular Weight: 374 aa, 42 kDa Observed Molecular Weight: 40-42 kDa GenBank Accession Number: BC011700 Gene Symbol: Glutamine Synthetase Gene ID (NCBI): 2752 RRID: AB_2110650 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924