Iright
BRAND / VENDOR: Proteintech

Proteintech, 11063-1-AP, SYCE1 Polyclonal antibody

CATALOG NUMBER: 11063-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SYCE1 (11063-1-AP) by Proteintech is a Polyclonal antibody targeting SYCE1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11063-1-AP targets SYCE1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Synaptonemal Complex Central Element 1 (Syce1) is a major component of the synaptonemal complex (SC), which is formed between homologous chromosomes during meiotic prophase and exists only during the first meiotic division. The SYCE1 structural core, formed by an N-terminal region of amino acids 25-179, is an α-helical dimer that adopts an anti-parallel "coiled-coil"-like structure of approximately 20 nm in length (PMID: 30607510). The male Syce1 null mice had abundant primary spermatocytes and lacked postmeiotic cells; arrested cells were likely eliminated by accelerated apoptosis ( PMID: 25899990). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1527 Product name: Recombinant human SYCE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-271 aa of BC034821 Sequence: KNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAREICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVA Predict reactive species Full Name: synaptonemal complex central element protein 1 Calculated Molecular Weight: 315 aa, 36 kDa Observed Molecular Weight: 40-44 kDa GenBank Accession Number: BC034821 Gene Symbol: SYCE1 Gene ID (NCBI): 93426 RRID: AB_2197057 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N0S2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924