Iright
BRAND / VENDOR: Proteintech

Proteintech, 11066-1-AP, ABCB9 Polyclonal antibody

CATALOG NUMBER: 11066-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ABCB9 (11066-1-AP) by Proteintech is a Polyclonal antibody targeting ABCB9 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11066-1-AP targets ABCB9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BGC-823 cells, HL-60 cells, human testis tissue, K-562 cells, mouse thymus tissue Positive IP detected in: mouse thymus tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1542 Product name: Recombinant human ABCB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-181 aa of BC017348 Sequence: EDIRHFNIFDSVLDLWAACLYRSCLLLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMVKLLLFSEVRRPIRDPWFWALFVWTYISLGASFLLWWLLSTVRPGTQALEPGAATEAEGFPGSGRPPPEQASGATLQKLLSYT Predict reactive species Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 9 Calculated Molecular Weight: 84 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC017348 Gene Symbol: ABCB9 Gene ID (NCBI): 23457 RRID: AB_10898357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP78 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924