Proteintech, 11074-2-AP, BORIS Polyclonal antibody

Size: 20ul / 150ul The BORIS (11074-2-AP) by Proteintech is a Polyclonal antibody targeting BORIS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11074-2-AP targets BORIS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CTCFL, also named BORIS (for brother of the regulator of imprinted sites) is a paralogue of the 11 zinc-finger transcription factor, CTCF. It is predominantly expressed in spermatocytes in the testis, also can be found in tumors and cancer cell lines. It mainly participates in insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. It has a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. Present polyclonal anti-CFCFL antibody(11074-2-AP) is produced by immunizing animals with part of C-terminal chain of CTCFL and detect a 75-kDa band and a 55-kDa band. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1547 Product name: Recombinant human BORIS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-663 aa of BC130486 Sequence: VRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQKHGENVPKYQCPHCATIIARKSDLRVHMRNLHAYSAAELKCRYCSAVFHERYALIQHQKTHKNEKRFKCKHCSYACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQLLNAHFRKYHDANFIPTVYKCSKCGKGFSRWINLHRHSEKCGSGEAKSAASGKGRRTRKRKQTILKEATKGQKEAAKGWKEAANGDEAAAEEASTTKGEQFPGEMFPVACRETTARVKEEVDEGVTCEMLLNTMDK Predict reactive species Full Name: CCCTC-binding factor (zinc finger protein)-like Calculated Molecular Weight: 82 kDa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC130486 Gene Symbol: BORIS/CTCFL Gene ID (NCBI): 140690 RRID: AB_614983 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NI51 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.