Product Description
Size: 20ul / 150ul
The Oligophrenin 1 (11076-1-AP) by Proteintech is a Polyclonal antibody targeting Oligophrenin 1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples
11076-1-AP targets Oligophrenin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, mouse brain tissue
Positive IP detected in: mouse brain tissue
Positive IHC detected in: human cerebellum tissue, human retinoblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
The OPHN1 gene encodes a Rho-GTPase activating protein (RhoGAP), and mutations in OPHN1 are responsible for non-specific X-linked mental retardation (NSMR). OPHN1 is highly expressed in the brain and present both pre- and postsynaptically in neurons.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag1536 Product name: Recombinant human OPHN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-722 aa of BC059393 Sequence: DSSQCASIPYNGQGYPEPYVPEGGAYLPDREPFIVPVEPERTAEYEDDYGADEPEQQHPDHRRWRRALRPGPG Predict reactive species
Full Name: oligophrenin 1
Calculated Molecular Weight: 802 aa, 92 kDa
Observed Molecular Weight: 92 kDa
GenBank Accession Number: BC059393
Gene Symbol: Oligophrenin 1
Gene ID (NCBI): 4983
RRID: AB_2158306
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O60890
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924