Proteintech, 11078-1-AP, SLCO6A1 Polyclonal antibody

Size: 20ul / 150ul The SLCO6A1 (11078-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO6A1 in WB, ELISA applications with reactivity to human, mouse samples 11078-1-AP targets SLCO6A1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HEK-293T cells, Jurkat cells, K-562 cells, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SLCO6A1, also named as OATP6A1 and SLC21A19, belongs to the organic anion transporter protein (OATPs) family. OATP proteins are reported to mediate the transport of a variety of low molecular weight substrates, such as drugs, toxins and steroid hormone conjugates. SLCO6A1 is strongly expressed in testis and weakly expressed in spleen, brain, fetal brain and placenta. SLCO6A1 has 3 isoforms with the molecular mass of 51, 73 and 79 kDa. (PMID: 26861727) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1532 Product name: Recombinant human SLCO6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 570-657 aa of BC034976 Sequence: PSIFKMSGETSCILRDVNKCGHTGRCWIYNKTKMAFLLVGICFLCKLCTIIFTTIAFFIYKRRLNENTDFPDVTVKNPKVKKKEETDL Predict reactive species Full Name: solute carrier organic anion transporter family, member 6A1 Calculated Molecular Weight: 719aa,79 kDa; 657aa,73 kDa Observed Molecular Weight: 73-80 kDa, 51 kDa GenBank Accession Number: BC034976 Gene Symbol: SLCO6A1 Gene ID (NCBI): 133482 RRID: AB_2189858 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UG4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.