Proteintech, 11086-2-AP, NME1 Polyclonal antibody

Size: 20ul / 150ul The NME1 (11086-2-AP) by Proteintech is a Polyclonal antibody targeting NME1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 11086-2-AP targets NME1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, multi-cells Positive IP detected in: A549 cells Positive IHC detected in: human liver tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NME1 is also named as NDPKA(Nucleoside diphosphate kinase A), NM23(Metastasis inhibition factor nm23),GAAD(Granzyme A-activated DNase) and belongs to the NDK family.It is a major role in the synthesis of nucleoside triphosphates other than ATP and required for neural development including neural patterning and cell fate determination.It has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1548 Product name: Recombinant human NME1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC018994 Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE Predict reactive species Full Name: non-metastatic cells 1, protein (NM23A) expressed in Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC018994 Gene Symbol: NME1 Gene ID (NCBI): 4830 RRID: AB_2152689 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15531 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.