Proteintech, 11100-2-AP, Arrestin C Polyclonal antibody

Size: 20ul / 150ul The Arrestin C (11100-2-AP) by Proteintech is a Polyclonal antibody targeting Arrestin C in WB, IHC, IF, ELISA applications with reactivity to human, mouse, rat samples 11100-2-AP targets Arrestin C in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse eye tissue, mouse heart tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: Retinal organoids, mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF): IF : 1:10-1:100 Background Information Arrestin C, also known as Arrestin 3 or Retinal Cone Arrestin, is a protein encoded by the ARR3 gene. It belongs to the arrestin family, which plays a crucial role in regulating G-protein-coupled receptor (GPCR) signaling and trafficking. Arrestin C is composed of two major domains: the N-domain and the C-domain, connected by a hinge region. These domains form a structure resembling two clamshells placed end-to-end. The C-terminal tail (C-tail) of Arrestin C interacts extensively with the N-domain, stabilizing its basal conformation. Arrestin C is predominantly expressed in cone photoreceptors and pinealocytes in the retina. It is involved in the shut-off mechanisms associated with high-acuity color vision by binding to phosphorylated and activated opsins, thereby inhibiting their ability to interact with transducin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1580 Product name: Recombinant human ARR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC012096 Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS Predict reactive species Full Name: arrestin 3, retinal (X-arrestin) Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC012096 Gene Symbol: Arrestin C Gene ID (NCBI): 407 RRID: AB_2289959 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36575 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.