Product Description
Size: 20ul / 150ul
The TIM10 (11124-2-AP) by Proteintech is a Polyclonal antibody targeting TIM10 in WB, ELISA applications with reactivity to human samples
11124-2-AP targets TIM10 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF-7 cells, MDA-MB-231 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human
Cited Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag1615 Product name: Recombinant human TIMM10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC032133 Sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA Predict reactive species
Full Name: translocase of inner mitochondrial membrane 10 homolog (yeast)
Calculated Molecular Weight: 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC032133
Gene Symbol: TIMM10
Gene ID (NCBI): 26519
RRID: AB_2201981
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P62072
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924