Iright
BRAND / VENDOR: Proteintech

Proteintech, 11133-1-AP, TBX22 Polyclonal antibody

CATALOG NUMBER: 11133-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TBX22 (11133-1-AP) by Proteintech is a Polyclonal antibody targeting TBX22 in WB, ELISA applications with reactivity to human, mouse, rat samples 11133-1-AP targets TBX22 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The frontonasal mass gives rise to the facial midline and fuses with the maxillary prominence to form the upper lip. T-box transcription factor 22 (Tbx22) belongs to the T-box family of transcription factors, which is essential for normal craniofacial development[PMID: 20033915]. Mutation in TBX22 in the frontnasal mass is reported in families with X-linked cleft palate and ankyloglossia [PMID:19816249]. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1591 Product name: Recombinant human TBX22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 192-520 aa of BC014194 Sequence: QIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPWRPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHLPTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHYL Predict reactive species Full Name: T-box 22 Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC014194 Gene Symbol: TBX22 Gene ID (NCBI): 50945 RRID: AB_2200683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y458 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924