Proteintech, 11147-2-AP, SEC61G Polyclonal antibody

Size: 20ul / 150ul The SEC61G (11147-2-AP) by Proteintech is a Polyclonal antibody targeting SEC61G in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11147-2-AP targets SEC61G in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: EC109 cells, HEK-293 cells, DC2.4 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SEC61G is a subunit of the SEC61 complex, which also contains alpha (SEC61A) and beta (SEC61B) subunits. The SEC61 complex is the central component of the protein translocation apparatus on the endoplasmic reticulum membrane. The gene of SEC61G maps to chromosome 7p11.2, and encodes a 68-amino acid single-pass membrane protein. This antibody can recognize endogenous SEC61G that migrates at a molecular mass of ~8 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1624 Product name: Recombinant human SEC61G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC009480 Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG Predict reactive species Full Name: Sec61 gamma subunit Calculated Molecular Weight: 7.7 kDa Observed Molecular Weight: 7.7 kDa GenBank Accession Number: BC009480 Gene Symbol: SEC61G Gene ID (NCBI): 23480 RRID: AB_2254450 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60059 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.