Iright
BRAND / VENDOR: Proteintech

Proteintech, 11149-1-AP, EIF4E Polyclonal antibody

CATALOG NUMBER: 11149-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EIF4E (11149-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4E in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 11149-1-AP targets EIF4E in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IHC detected in: human breast cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins. This is a rabbit polyclonal antibody raised against the full-length human EIF4E. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1626 Product name: Recombinant human EIF4E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC012611 Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV Predict reactive species Full Name: eukaryotic translation initiation factor 4E Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 26-29 kDa GenBank Accession Number: BC012611 Gene Symbol: EIF4E Gene ID (NCBI): 1977 RRID: AB_2097686 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06730 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924