Iright
BRAND / VENDOR: Proteintech

Proteintech, 11159-1-AP, ABCD1 Polyclonal antibody

CATALOG NUMBER: 11159-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ABCD1 (11159-1-AP) by Proteintech is a Polyclonal antibody targeting ABCD1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11159-1-AP targets ABCD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, HeLa cells, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information ABCD1 (also known as ALDP) is a member of the ATP-binding cassette (ABC) transporter superfamily which functions as transporter for a wide variety of substrates. It localizes to the peroxisomal membrane. The exact function is not clear so far. Various mutations of ABCD1 cause X-linked adrenoleukodystrophy (X-ALD), an inherited neurodegenerative disease affecting the nervous system white matter and adrenal cortex. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1635 Product name: Recombinant human ABCD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-507 aa of BC025358 Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG Predict reactive species Full Name: ATP-binding cassette, sub-family D (ALD), member 1 Calculated Molecular Weight: 745 aa, 83 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC025358 Gene Symbol: ABCD1 Gene ID (NCBI): 215 RRID: AB_2219775 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P33897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924