Proteintech, 11176-1-AP, HNRNPA1 Polyclonal antibody

Size: 20ul / 150ul The HNRNPA1 (11176-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 11176-1-AP targets HNRNPA1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, mouse colon tissue, K-562 cells, Neuro-2a cells, C6 cells Positive IHC detected in: mouse pancreas tissue, human breast cancer tissue, human colon tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information In eukaryotic cells, nascent RNA polymerase II transcripts are associated in the nucleus with specific proteins to form ribonucleoprotein complexes called HNRP or 40S. Protein moiety of the HNRP particle has 6 major components called core proteins, and HNRPA1 is one of them. hnRNP A1 is a multifunctional RNA binding protein which is involved in pre-mRNA splicing, export of mature transcripts from the nucleus, mRNA turnover, and internal ribosome entry site (IRES)-mediated translation. HNRNPA1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1656 Product name: Recombinant human HNRNPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC009600 Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein A1 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34, 40 kDa GenBank Accession Number: BC009600 Gene Symbol: HNRNPA1 Gene ID (NCBI): 3178 RRID: AB_2117177 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.