Iright
BRAND / VENDOR: Proteintech

Proteintech, 11213-1-AP, Nectin 3 Polyclonal antibody

CATALOG NUMBER: 11213-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Nectin 3 (11213-1-AP) by Proteintech is a Polyclonal antibody targeting Nectin 3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11213-1-AP targets Nectin 3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Nectin 3, also known as CD113, is a member of the nectin family of cell adhesion molecules. It plays a crucial role in cell-cell adhesion and the formation of adherens junctions, which are essential for maintaining tissue integrity and cell polarity. Nectin 3 can form homophilic and heterophilic interactions, meaning it can bind to itself or other nectin family members, such as Nectin-2 (PMID: 10744716; 22902367). These interactions are important for processes like cell migration, tissue development, and immune cell transmigration (PMID: 12901789; 24116228). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1712 Product name: Recombinant human PVRL3, Nectin 3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 449-549 aa of BC017572 Sequence: MQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV Predict reactive species Full Name: poliovirus receptor-related 3 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC017572 Gene Symbol: Nectin-3 Gene ID (NCBI): 25945 RRID: AB_2269095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924