Iright
BRAND / VENDOR: Proteintech

Proteintech, 11237-1-AP, MIRO2 Polyclonal antibody

CATALOG NUMBER: 11237-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MIRO2 (11237-1-AP) by Proteintech is a Polyclonal antibody targeting MIRO2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11237-1-AP targets MIRO2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, human kidney tissue, mouse heart tissue, L02 cells, HepG2 cells, human testis tissue, human heart tissue, K-562 cells, Hela cells Positive IP detected in: L02 cells Positive IHC detected in: human colon tissue, human kidney tissue, human heart tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RHOT2 (Ras homolog gene family, member T2), also known as ARHT2, RASL or MIRO-2 (mitochondrial Rho GTPase 2), is a 618 amino acid single-pass type IV membrane protein as a member of the Rho family of GTPases. It is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. RHOT2 is ubiquitously expressed with highest levels found in pancreas, heart, kidney and skeletal muscle. MIRO2 is highly phosphorylated at basal conditions, as evidenced by an immunoreactive band that electrophoretically migrates 7 kDa higher (~75 kDa) compared to its predicted molecular weight (68 kDa) (PMID: 28556983). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1752 Product name: Recombinant human RHOT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 319-618 aa of BC014942 Sequence: DRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQ Predict reactive species Full Name: ras homolog gene family, member T2 Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC014942 Gene Symbol: RHOT2 Gene ID (NCBI): 89941 RRID: AB_2179539 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXI1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924