Iright
BRAND / VENDOR: Proteintech

Proteintech, 11238-1-AP, NDUFV1 Polyclonal antibody

CATALOG NUMBER: 11238-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NDUFV1 (11238-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFV1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11238-1-AP targets NDUFV1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, U2OS cells, mouse heart tissue Positive IP detected in: A431 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DUFV1(NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial) is also named as UQOR1,Complex I-51kD and belongs to the complex I 51 kDa subunit family. It is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. It has 2 isoforms produced by alternative splicing. Defects in NDUFV1 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1764 Product name: Recombinant human NDUFV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-447 aa of BC015645 Sequence: NADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELE Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC015645 Gene Symbol: NDUFV1 Gene ID (NCBI): 4723 RRID: AB_2149040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49821 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924