Iright
BRAND / VENDOR: Proteintech

Proteintech, 11252-2-AP, PMM1 Polyclonal antibody

CATALOG NUMBER: 11252-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PMM1 (11252-2-AP) by Proteintech is a Polyclonal antibody targeting PMM1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11252-2-AP targets PMM1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, HepG2 cells, NIH/3T3 cells Positive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PMM1, also named as PMMH22, belongs to the eukaryotic PMM family. It catalyzes the second step in the conversion of fructose-6P to GDP-mannoseis and is involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. In addition, PMM1 may be responsible for the degradation of glucose-1,6-bisphosphate in ischemic brain(PMID:18927083). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1782 Product name: Recombinant human PMM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-262 aa of BC016818 Sequence: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA Predict reactive species Full Name: phosphomannomutase 1 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC016818 Gene Symbol: PMM1 Gene ID (NCBI): 5372 RRID: AB_2166971 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92871 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924