Iright
BRAND / VENDOR: Proteintech

Proteintech, 11267-1-AP, XRN2 Polyclonal antibody

CATALOG NUMBER: 11267-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The XRN2 (11267-1-AP) by Proteintech is a Polyclonal antibody targeting XRN2 in WB, ELISA applications with reactivity to human samples 11267-1-AP targets XRN2 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, COLO 320 cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information XRN2 is one exonuclease that degrades the Pol II associated product of poly(A) site cleavage, which is crucial for Pol II termination. During transcription termination, XRN2 cleavages at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1788 Product name: Recombinant human XRN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 651-950 aa of BC006417 Sequence: PFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN Predict reactive species Full Name: 5'-3' exoribonuclease 2 Calculated Molecular Weight: 104 kDa Observed Molecular Weight: 104 kDa GenBank Accession Number: BC006417 Gene Symbol: XRN2 Gene ID (NCBI): 22803 RRID: AB_2288787 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0D6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924