Proteintech, 11304-1-AP, Rab18 Polyclonal antibody

Size: 20ul / 150ul The Rab18 (11304-1-AP) by Proteintech is a Polyclonal antibody targeting Rab18 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 11304-1-AP targets Rab18 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human heart tissue, human brain tissue, PC-3 cells, human testis tissue, mouse testis tissue, rat brain tissue Positive IP detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: human stomach cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RAB18 is a member of a family of Ras-related small GTPases. RAB18 plays a role in apical endocytosis/recycling, and may be implicated in transport between the plasma membrane and early endosomes. It also plays a key role in eye and brain development and neurodegeneration. Defects in RAB18 are associated with Warburg micro syndrome type 3. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1841 Product name: Recombinant human RAB18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC015014 Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL Predict reactive species Full Name: RAB18, member RAS oncogene family Calculated Molecular Weight: 206 aa, 23 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC015014 Gene Symbol: RAB18 Gene ID (NCBI): 22931 RRID: AB_2173932 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.