Proteintech, 11309-1-AP, EIF5A Polyclonal antibody

Size: 20ul / 150ul The EIF5A (11309-1-AP) by Proteintech is a Polyclonal antibody targeting EIF5A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11309-1-AP targets EIF5A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, PC-3 cells, SH-SY5Y cells, mouse brain tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Translation of messenger RNA (mRNA) to protein in eukaryotesis a crucial process in protein biosynthesis, in which initiation of translation involves interaction of different eukaryotic translation initiation factors (eIFs), ribosome subunits and mRNAs. Eukaryotic translation initiation factor 5A (EIF5A) is one of the eIFs involved in translation initiation. EIF5A has a essential role in cell viability and the only protein known to contain the amino acid residue hypusine, formed by post-translational modification of a specific lysine residue. Firstly identified as a translation initiation factor, it also has a function in the elongation step of translation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1849 Product name: Recombinant human EIF5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC001832 Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK Predict reactive species Full Name: eukaryotic translation initiation factor 5A Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC001832 Gene Symbol: EIF5A Gene ID (NCBI): 1984 RRID: AB_2262001 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.