Iright
BRAND / VENDOR: Proteintech

Proteintech, 11312-1-AP, IRF3 Polyclonal antibody

CATALOG NUMBER: 11312-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IRF3 (11312-1-AP) by Proteintech is a Polyclonal antibody targeting IRF3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 11312-1-AP targets IRF3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HCT 116 cells, Jurkat cells, MCF-7 cells, MDA-MB-231 cells, HeLa cells Positive IP detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The virul-induced expression of interferon(IFN) genes in infected cells implicate in the interplay of several constitutively expressed and virus-activated transcription factors. A family of IFN regulatory factors(IRFs) have been shown to has a role in the transcription of IFN genes as well as IFN-stimulated genes. IRF3 is a novel key transcriptional regulator of type I IFN-dependent immune responses and involves in the innate immune response against DNA and RNA viruses, by binding to the promoters of IFN. It located in the cytoplasm of uninfected cells in an inactive form, and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, could be phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization, nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes. IRF3 exists some isoforms with MV 47-49 kDa, 33 kDa and 12-16 kDa. Specification Tested Reactivity: human Cited Reactivity: human, rat, pig, monkey, bovine, hamster, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1858 Product name: Recombinant human IRF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-452 aa of BC009395 Sequence: MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPGPAVDQEARDGQGCAHVPQGLGRNGPGRGCLLPGEYCGPAHFQQPPTLPHLRPVQGLPAGLGGGHGFPGPWGDLSPRSSWCASNPPVPHHLNQ Predict reactive species Full Name: interferon regulatory factor 3 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC009395 Gene Symbol: IRF3 Gene ID (NCBI): 3661 RRID: AB_2127004 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14653 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924