Proteintech, 11314-1-AP, EYA2 Polyclonal antibody

Size: 20ul / 150ul The EYA2 (11314-1-AP) by Proteintech is a Polyclonal antibody targeting EYA2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11314-1-AP targets EYA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Y79 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EYA2, also named EAB1, belongs to the HAD-like hydrolase superfamily and EYA family. It coactivates SIX1. The Six1-EYA2 interaction may inhibit breast cancer progression. EYA2 is required for Six1-activated TGF-beta signaling.(PMID:21706047) It may be involved in the development of the eye. This protein has 3 isoforms produced by alternative splicing with the molecular weight of 59 kDa, 57 kDa, and 50 kDa. It can be detected two bands of 70 kDa and 56 kDa in the neuroblastoma cells by western blot(PMID:12039049). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1860 Product name: Recombinant human EYA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-583 aa of BC013882 Sequence: LSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL Predict reactive species Full Name: eyes absent homolog 2 (Drosophila) Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 56 kDa and 70 kDa GenBank Accession Number: BC013882 Gene Symbol: EYA2 Gene ID (NCBI): 2139 RRID: AB_10733651 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00167 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.