Iright
BRAND / VENDOR: Proteintech

Proteintech, 11326-1-AP, LAT Polyclonal antibody

CATALOG NUMBER: 11326-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LAT (11326-1-AP) by Proteintech is a Polyclonal antibody targeting LAT in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11326-1-AP targets LAT in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse thymus Positive IP detected in: Jurkat cells Positive IHC detected in: human thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LAT is a membrane-localized adaptor protein which is primarily concentrated in microdomains by palmitoylation. LAT plays a central role in T-cell activation by nucleating signaling complexes that are critical for the propagation of T-cell signals from the plasma membrane to the cellular interior. In addition to being a positive regulator of T cell signaling, LAT also recruits several negative regulatory proteins, including kinases, phosphatases, and ubiquitin ligases, which ultimately leads to signal termination. LAT is subject to ubiquitylation, and ubiquitin-resistant mutants of LAT display enhanced signaling. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1868 Product name: Recombinant human LAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC011563 Sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN Predict reactive species Full Name: linker for activation of T cells Calculated Molecular Weight: 262 aa, 28 kDa Observed Molecular Weight: 36-38 kDa GenBank Accession Number: BC011563 Gene Symbol: LAT Gene ID (NCBI): 27040 RRID: AB_10695624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43561 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924