Proteintech, 11328-1-AP, Integrin Beta 7 Polyclonal antibody

Size: 20ul / 150ul The Integrin Beta 7 (11328-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin Beta 7 in WB, IHC, ELISA applications with reactivity to human samples 11328-1-AP targets Integrin Beta 7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, human lung tissue, K-562 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ITGB7 (integrin, beta7) is a single-pass type I membrane protein that belongs to the integrin beta chain family. The integrins are a large family of cell-surface glycoprotein receptors that play key roles in leucocyte adhesion, signalling, proliferation and migration by binding as heterodimers to specific ligands. The beta7 integrin associates with alpha4 integrin to form a heterodimer, alpha4/beta7, which interacts with MADCAM1, VCAM, fibronectin, and may also interact with HIV-1 gp120. The beta7 integrin can also form a heterodimer with alphaE integrin, and the dimer, alphaE/beta7 integrin, is a receptor for E-cadherin. ITGB7 is expressed in a variety of leukocyte lines. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1871 Product name: Recombinant human Integrin beta-7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-798 aa of BC015916 Sequence: VCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKSAITTTINPRFQEADSPTL Predict reactive species Full Name: integrin, beta 7 Calculated Molecular Weight: 798 aa, 87 kDa Observed Molecular Weight: 87-100 kDa GenBank Accession Number: BC015916 Gene Symbol: Integrin beta 7 Gene ID (NCBI): 3695 RRID: AB_2249380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26010 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.