Proteintech, 11330-1-AP, DNASE1L3 Polyclonal antibody

Size: 20ul / 150ul The DNASE1L3 (11330-1-AP) by Proteintech is a Polyclonal antibody targeting DNASE1L3 in WB, ELISA applications with reactivity to human samples 11330-1-AP targets DNASE1L3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:200-1:600 Background Information Deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+/Mg2+ dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences [PMID:15796714]. It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3'-OH/5'-P ends, which is Ca2+/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin [PMID:9665719]. In addition, it has been suggested to be involved in apoptotic DNA fragmentation of thymocytes neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease [PMID: 7957253, 9307016] Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1873 Product name: Recombinant human DNASE1L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC015831 Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS Predict reactive species Full Name: deoxyribonuclease I-like 3 Calculated Molecular Weight: 305 aa, 36 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC015831 Gene Symbol: DNASE1L3 Gene ID (NCBI): 1776 RRID: AB_2095527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.