Proteintech, 11335-1-AP, IRF1 Polyclonal antibody

Size: 20ul / 150ul The IRF1 (11335-1-AP) by Proteintech is a Polyclonal antibody targeting IRF1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 11335-1-AP targets IRF1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IFN gamma treated HeLa cells, HL-60 cells, IFN gamma treated THP-1 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: IFN gamma treated HepG2 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information IRF1, also named as IFN regulatory factor 1, is a 325 amino acid protein, which belongs to the IRF family. IRF1 as a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. The calculated molecular weight of IRF1 is 37 kDa, but the modified IRF1 protein is about 45-50 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, rabbit, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1879 Product name: Recombinant human IRF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-325 aa of BC009483 Sequence: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP Predict reactive species Full Name: IRF 1 Calculated Molecular Weight: 325 aa, 37 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC009483 Gene Symbol: IRF1 Gene ID (NCBI): 3659 RRID: AB_2877759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10914 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.