Iright
BRAND / VENDOR: Proteintech

Proteintech, 11336-1-AP, CBFA2T2 Polyclonal antibody

CATALOG NUMBER: 11336-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CBFA2T2 (11336-1-AP) by Proteintech is a Polyclonal antibody targeting CBFA2T2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11336-1-AP targets CBFA2T2 in WB, IHC, chIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse testis tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Core-binding factor, runt domain, alpha subunit 2, translocated to 2(CBFA2T2) belongs to a family of ubiquitously expressed transcriptional repressors that interact with transcription factors bound to promoters of target genes and with histone deacetylases (HDACs) critical for enforcement of repressor function.CBFA2T2, also named as MTGR1 or EHT, is an 85-kDa phosphoprotein. It can bind AML1-MTG8 fusion protein in acute myeloid leukemia. The binding leads to an enhancement of cell proliferation mediated in a murine myeloid model. The calculated molecular weight of CBFA2T2 is 67 kDa, but modified SMARCE1 is about 80 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1880 Product name: Recombinant human CBFA2T2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-263 aa of BC015066 Sequence: MHGSPVEVKIQSRSSPPTMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPESCIIHLKSMGVASRHEYFSGTLQMPAHPVRNSTLENLWVDCSRSLRSTVLPFP Predict reactive species Full Name: core-binding factor, runt domain, alpha subunit 2; translocated to, 2 Calculated Molecular Weight: 604 aa, 67 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC015066 Gene Symbol: CBFA2T2 Gene ID (NCBI): 9139 RRID: AB_2070571 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924