Iright
BRAND / VENDOR: Proteintech

Proteintech, 11355-1-AP, DHX58/LGP2 Polyclonal antibody

CATALOG NUMBER: 11355-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DHX58/LGP2 (11355-1-AP) by Proteintech is a Polyclonal antibody targeting DHX58/LGP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11355-1-AP targets DHX58/LGP2 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat kidney tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human breast cancer tissue, human nephroblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DHX58(Probable ATP-dependent RNA helicase DHX58) is also named as D11LGP2E, LGP2 and belongs to the RLR subfamily. DHX58, originally identified as a highly expressed gene in mammary tumors, is another cytoplasmic DEX(D/H)-box helicase that can recognize RNA(PMID: 18411269). It acts as a positive, but not negative, regulator of RIG-I-and MDA5-dependent recognition of RNA virus infection and plays a pivotal role in antiviral responses in vivo(PMID:20080593). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, monkey, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1910 Product name: Recombinant human DHX58 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-678 aa of BC014949 Sequence: LFDDRKNELAHLATHGPENPKLEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD Predict reactive species Full Name: DEXH (Asp-Glu-X-His) box polypeptide 58 Calculated Molecular Weight: 678 aa, 77 kDa Observed Molecular Weight: 77 kDa GenBank Accession Number: BC014949 Gene Symbol: DHX58 Gene ID (NCBI): 79132 RRID: AB_2092319 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96C10 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924