Iright
BRAND / VENDOR: Proteintech

Proteintech, 11366-1-AP, HINT3 Polyclonal antibody

CATALOG NUMBER: 11366-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HINT3 (11366-1-AP) by Proteintech is a Polyclonal antibody targeting HINT3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11366-1-AP targets HINT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, human placenta tissue Positive IHC detected in: mouse liver tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Human Hint3 (hHint3) has been classified as a member of the histidine triad nucleotide (Hint) binding protein subfamily. HIT superfamily consists primarily of nucleoside phosphoramidases, dinucleotide hydrolases, and nucleotidyl transferases. While Hint1 is ubiquitously expressed by both eukaryotes and prokaryotes, Hint3 is found only in eukaryotes. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1912 Product name: Recombinant human HINT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC015732 Sequence: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT Predict reactive species Full Name: histidine triad nucleotide binding protein 3 Calculated Molecular Weight: 182 aa, 20 kDa Observed Molecular Weight: 20-24 kDa GenBank Accession Number: BC015732 Gene Symbol: HINT3 Gene ID (NCBI): 135114 RRID: AB_3669127 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQE9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924