Proteintech, 11400-1-AP, ASRGL1 Polyclonal antibody

Size: 20ul / 150ul The ASRGL1 (11400-1-AP) by Proteintech is a Polyclonal antibody targeting ASRGL1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11400-1-AP targets ASRGL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Asparaginase-like protein 1 (ASRGL1) is also named as ALP, CRASH and belongs to the Ntn-hydrolase family. ASRGL1 has both L-asparaginase and beta-aspartyl peptidase activity. It may be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. ASRGL1 has 2 isoforms produced by alternative splicing with the MW of 32 kDa and 19 kDa. Two lower molecular weight bands (23 and 15 kDa) can be detected corresponding to the processed α and β subunits (PMID: 27106100). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, cat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1955 Product name: Recombinant human ASRGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC021295 Sequence: MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP Predict reactive species Full Name: asparaginase like 1 Calculated Molecular Weight: 308 aa, 32 kDa Observed Molecular Weight: 32-40 kDa, 20-25 kDa, 15-19 kDa GenBank Accession Number: BC021295 Gene Symbol: ASRGL1 Gene ID (NCBI): 80150 RRID: AB_2060440 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L266 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.