Iright
BRAND / VENDOR: Proteintech

Proteintech, 11411-2-AP, COX7C Polyclonal antibody

CATALOG NUMBER: 11411-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The COX7C (11411-2-AP) by Proteintech is a Polyclonal antibody targeting COX7C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11411-2-AP targets COX7C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse ovary tissue, human skeletal muscle tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. COX7C (Cytochrome c oxidase subunit 7C, mitochondrial) is one of the subunits, catalyzing the elctron transfer from reduced cytochrome c to molecule oxygen. This protein belongs to the cytochrome c oxidase VIIc family. The calculated molecular weight of COX7C is 7 kDa, but due to the presence of the complex, a complex form of 28 kDa may also be observed. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1989 Product name: Recombinant human COX7C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC007498 Sequence: MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT Predict reactive species Full Name: cytochrome c oxidase subunit VIIc Calculated Molecular Weight: 63 aa, 7 kDa Observed Molecular Weight: 15~28 kDa GenBank Accession Number: BC007498 Gene Symbol: COX7C Gene ID (NCBI): 1350 RRID: AB_2085713 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15954 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924