Iright
BRAND / VENDOR: Proteintech

Proteintech, 11418-2-AP, COX5B Polyclonal antibody

CATALOG NUMBER: 11418-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The COX5B (11418-2-AP) by Proteintech is a Polyclonal antibody targeting COX5B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11418-2-AP targets COX5B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COX5B belongs to the cytochrome c oxidase subunit 5B family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX5B and other 3 genes CKB, HBB, MBP are involved in respiration.(PMID:21295140) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1986 Product name: Recombinant human COX5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC006229 Sequence: MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH Predict reactive species Full Name: cytochrome c oxidase subunit Vb Calculated Molecular Weight: 129 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC006229 Gene Symbol: COX5B Gene ID (NCBI): 1329 RRID: AB_2245376 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10606 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924