Iright
BRAND / VENDOR: Proteintech

Proteintech, 11423-1-AP, EIF3M Polyclonal antibody

CATALOG NUMBER: 11423-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EIF3M (11423-1-AP) by Proteintech is a Polyclonal antibody targeting EIF3M in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11423-1-AP targets EIF3M in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, mouse brain tissue, rat brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EIF3M gene encodes eukaryotic translation initiation factor (eIF) subunit M, also called GA17 or PCID1. eIF-3 complex is required for several steps in the initiation of protein synthesis, and recent studies indicate that regulation of oncogene expression and neoplastic transformation are controlled by eIF subunits. The most uncharacterized non-core subunit EIF3M was confirmed to be highly expressed in human cancer cell lines and colon cancer patient tissues and mediate regulation of tumorigenesis-related genes in human colon cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1994 Product name: Recombinant human EIF3M protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-374 aa of BC019103 Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit M Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 35-43 kDa GenBank Accession Number: BC019103 Gene Symbol: EIF3M Gene ID (NCBI): 10480 RRID: AB_2246386 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L2H7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924