Proteintech, 11424-1-AP, RARG Polyclonal antibody

Size: 20ul / 150ul The RARG (11424-1-AP) by Proteintech is a Polyclonal antibody targeting RARG in WB, IP, ELISA applications with reactivity to human samples 11424-1-AP targets RARG in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IP detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Retinoic acid receptors (RARs) are nuclear hormone receptors that act as ligand-dependent transcriptional regulators. In their liganded state, RARs activate transcription, whereas in their nonliganded form, they repress transcription of their target genes. RARs have numerous target genes, which have retinoic response elements in their promoter regions (PMID:17574023). RARG is a member of the retinoid acid receptor (RAR) family, along with RARA, which is known to be involved PML/RARA fusion of acute promyelocytic leukemia, and RARB. and rearrangement that conferred to leukemic cells acute promyelocytic leukemia-like morphologic and immunophenotypic features (PMID:20935257). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1991 Product name: Recombinant human RARG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC019098 Sequence: MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH Predict reactive species Full Name: retinoic acid receptor, gamma Calculated Molecular Weight: 454 aa, 50 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC019098 Gene Symbol: RARG Gene ID (NCBI): 5916 RRID: AB_2175394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13631 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.